PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_26854.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 140aa    MW: 16424.2 Da    PI: 9.5555
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_26854.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.71.4e-092541163
                             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                             + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se+
  Rsa1.0_26854.1_g00001.1  2 MANRQSAARSKERKARYIMELERKVQSLQSEATTLSAQLSLFQRDTTGLSSEN 54
                             56**********************************99998877776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147034.45E-15146No hitNo description
PROSITE profilePS502179.335157IPR004827Basic-leucine zipper domain
SMARTSM003382.8E-7256IPR004827Basic-leucine zipper domain
PfamPF001701.8E-7254IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-8251No hitNo description
SuperFamilySSF579593.73E-9247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
IMANRQSAAR SKERKARYIM ELERKVQSLQ SEATTLSAQL SLFQRDTTGL SSENTELKLR  60
LQVMEQQAKL RDALNDQLKK EVERLKFATG EVSHADAYNL GMAHMQYSQQ QQQQQQQQQS  120
FFQHHHHHHH QQQQQQTDAQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742691e-113AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967461e-113AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankZ860931e-113Z86093.1 A.thaliana mRNA for b-Zip DNA binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142704.12e-68PREDICTED: transcription factor RF2b-like
RefseqXP_013747861.12e-68PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-52RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A078CS392e-68A0A078CS39_BRANA; BnaA05g01800D protein
TrEMBLA0A087H4803e-68A0A087H480_ARAAL; Uncharacterized protein
TrEMBLM4CK482e-68M4CK48_BRARP; Uncharacterized protein
STRINGBra004582.1-P6e-68(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.13e-66bZIP family protein